Tesamorelin specifications and molecular characteristics
The technical specification for Tesamorelin, the Tesamorelin research material supplied by Tesamorelin Research Supply: molecular formula C221H366N72O67S, average molecular weight 5135.86 g/mol, 44 residues, supplied as a lyophilized powder. Each item is explained below.
Last updated
Specification table
| Product | Tesamorelin |
|---|---|
| Type | Synthetic 44-residue GHRH analog |
| Molecular formula | C221H366N72O67S |
| Molecular weight | 5135.86 g/mol (average) |
| Length | 44 residues |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
| N-terminus | trans-3-Hexenoyl-Tyr1 |
| C-terminus | Amide (Leu44-NH2) |
| CAS number | 218949-48-5 |
| Receptor design | Growth hormone-releasing hormone receptor (GHRHR) |
| Form | Lyophilized powder |
| Vial sizes | 10 mg |
| Purity specification | ≥95% (HPLC-UV) |
| Purity, current lots | 99.54% |
| Identity specification | Confirmed by HPLC retention-time match |
| Testing laboratory | ILS Laboratories (independent) |
| Storage | Store sealed, dry and protected from light at the temperature stated on the vial label. Allow a cold vial to reach room temperature before opening. |
| Designation | Research use only |
Current lot results against specification
Every current lot meets the release specification. Current lots test at 99.54% by HPLC-UV against a specification of ≥95%, and identity is confirmed by HPLC retention-time match on every lot.
Tesamorelin molecular formula
The molecular formula of Tesamorelin is C221H366N72O67S. The formula includes the N-terminal trans-3-hexenoyl group and the C-terminal amide.
Tesamorelin molecular weight
The average molecular weight of Tesamorelin is 5135.86 g/mol. "Average" means it is calculated from natural isotope abundances.
Tesamorelin sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Written N- to C-terminus in one-letter code. Tyr1 carries the trans-3-hexenoyl group; Leu44 is amidated.
Structure and modifications
At 44 residues and over 5,100 g/mol, tesamorelin is one of the larger linear peptides in research catalogues. It contains a single methionine (Met27), the residue most likely to oxidize, and no cysteine, so there are no disulfide bonds. The N-terminal trans-3-hexenoyl group and the C-terminal amide are its only modifications.
Receptor classification
Tesamorelin is designed for activity at the growth hormone-releasing hormone receptor (GHRHR). GHRHR belongs to the class B (secretin family) of G protein-coupled receptors.
Physical form
Lyophilized powder, recorded as the appearance on every certificate. Lyophilization (freeze-drying) removes water, which slows most chemical degradation. What lyophilized means.
Purity and identity specifications
Tesamorelin Research Supply’s stated release specification is ≥95% HPLC-UV purity with identity confirmed by HPLC retention-time match against a reference standard. The current lot, KB-77284, reported 99.54%. How purity is measured, or how specifications fit into the quality and supply-chain process.
Analytical and testing methods
HPLC-UV for purity, HPLC-RTM for identity and laboratory quantitation for net content, performed on every lot by ILS Laboratories. Each lot is also screened for fentanyl by immunoassay. LAL endotoxin testing (USP <85>) and PCR microbial screening are reported for lots where they were run. Testing and quality control.
Research designation
Tesamorelin is designated research use only: supplied for laboratory research by qualified personnel. Research use only policy.
Buy Tesamorelin
10 mg vials. Current lot KB-77284 tested at 99.54% purity with identity confirmed by HPLC retention-time match against a reference standard. Current purchasing is available through Klow.bio.